Antibodies

View as table Download

Rabbit Polyclonal Anti-PKLR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKLR antibody: synthetic peptide directed towards the N terminal of human PKLR. Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Rabbit Polyclonal antibody to Pyruvate Kinase (liver/RBC) (pyruvate kinase, liver and RBC)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of Pyruvate Kinase (liver/RBC) (Uniprot ID#P30613)

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PKLR mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PKLR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1).
Modifications Unmodified

PKLR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 446-556 of human PKLR (NP_000289.1).
Modifications Unmodified

PKLR Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 375-574 of human PKLR (NP_000289.1).
Modifications Unmodified

Anti-PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PKLR mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated