Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Ring1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ring1A Antibody: Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A. |
Antibodies
View as table Download
Anti-RING1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A. |
Rabbit Polyclonal Anti-RING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: TGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIEL |
Rabbit Polyclonal Anti-RING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: APSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLAL |
Rabbit Polyclonal Anti-RING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the N terminal of human RING1. Synthetic peptide located within the following region: MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPI |
Rabbit Polyclonal Anti-RING1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: SDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFT |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI6F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RING1 mouse monoclonal antibody,clone OTI3G7
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RING1A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RING1A A. |
| Modifications | Unmodified |
RING1 mouse monoclonal antibody,clone OTI6F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RING1 mouse monoclonal antibody,clone OTI6F11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- RING1
Conjugates
- Unconjugated