Rabbit anti-AZGP1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AZGP1 |
Rabbit anti-AZGP1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AZGP1 |
Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI10F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) AZGP1 mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
AZGP1 mouse monoclonal antibody,clone OTI10F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
AZGP1 mouse monoclonal antibody,clone OTI10F2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
AZGP1 mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
2 Days
AZGP1 mouse monoclonal antibody,clone OTI2H3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |