CCNY rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCNY |
CCNY rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCNY |
Rabbit Polyclonal Anti-CCNY Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNY antibody: synthetic peptide directed towards the middle region of human CCNY. Synthetic peptide located within the following region: DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY |
Carrier-free (BSA/glycerol-free) CCNY mouse monoclonal antibody, clone OTI12F10 (formerly 12F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CCNY mouse monoclonal antibody,clone OTI5D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNY rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCNY |
Cyclin Y Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human CCNY (NP_859049.2). |
Modifications | Unmodified |
CCNY mouse monoclonal antibody, clone OTI12F10 (formerly 12F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNY mouse monoclonal antibody, clone OTI12F10 (formerly 12F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNY mouse monoclonal antibody,clone OTI5D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CCNY mouse monoclonal antibody,clone OTI5D11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |