Antibodies

Jump to Filters
View as table Download
CHRNG Rabbit Polyclonal Antibody
TA330432

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNG antibody: synthetic peptide directed towards the N terminal of human CHRNG. Synthetic peptide located within the following region: NYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDY
CHRNG Rabbit Polyclonal Antibody
TA374782

USD 220.00

3 Weeks

CHRNG Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 328-517 of human CHRNG (NP_005190.4).
Modifications Unmodified