Germany
Japan
United Kingdom
China
Rabbit anti-CREM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CREM |
Antibodies
View as table Download
Rabbit polyclonal anti-CREM antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREM. |
Rabbit Polyclonal Anti-CREM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREM antibody: synthetic peptide directed towards the N terminal of human CREM. Synthetic peptide located within the following region: MAAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELR |
Goat Polyclonal Antibody against CREM
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence LETLKDICSPKTDY, from the C Terminus of the protein sequence according to NP_853549.1; NP_874387.1; NP_874388.1; NP_874393.1; NP_874394.1; NP_877570.1; NP_877571.1; NP_877572.1; NP_877573.1; NP_878270.1; NP_898883.1. |
Rabbit Polyclonal Anti-Crem Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Crem antibody is: synthetic peptide directed towards the C-terminal region of Rat Crem. Synthetic peptide located within the following region: KNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE |
Carrier-free (BSA/glycerol-free) CREM mouse monoclonal antibody,clone OTI4H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CREM mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CREM mouse monoclonal antibody,clone OTI3C1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI4H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI4H9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI3C1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CREM mouse monoclonal antibody,clone OTI3C1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- CREM
Conjugates
- Unconjugated