Rabbit Polyclonal DRAM Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DRAM antibody was raised against a 16 amino acid synthetic peptide from near the amino terminus of human DRAM. The immunogen is located within amino acids 30 - 80 of DRAM. |
Rabbit Polyclonal Anti-DRAM Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DRAM antibody: synthetic peptide directed towards the N terminal of human DRAM. Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP |
Dram1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
DRAM1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRAM1 (NP_060840.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
