DRAM (DRAM1) Rabbit Polyclonal Antibody

CAT#: TA344175

Rabbit Polyclonal Anti-DRAM Antibody - N-terminal region

Product Images

WB Suggested Anti-DRAM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: A549 cell lysate. DRAM1 is supported by BioGPS gene expression data to be expressed in A549

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DRAM antibody: synthetic peptide directed towards the N terminal of human DRAM. Synthetic peptide located within the following region: TMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: DNA damage regulated autophagy modulator 1
• Database Link:
  NP_060840
  Entrez Gene 55332 Human
  UniProt ID Q8N682
• Background: This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.
• Synonyms: DRAM
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 92%; Pig: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane