Rabbit Polyclonal Anti-FNDC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FNDC8 antibody: synthetic peptide directed towards the N terminal of human FNDC8. Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL |
Carrier-free (glycerol/BSA-free) FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FNDC8 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
