Antibodies

View as table Download

Rabbit Polyclonal Anti-GH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC

Rabbit polyclonal anti-GH (Growth Hormone) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant human growth hormone

Rabbit Polyclonal anti-GH2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG

Carrier-free (BSA/glycerol-free) GH2 mouse monoclonal antibody,clone OTI5B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-GH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GH2

GH2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GH2

GH2 mouse monoclonal antibody,clone OTI5B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

GH2 mouse monoclonal antibody,clone OTI5B11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated