Antibodies

View as table Download

Rabbit Polyclonal Anti-IGF2BP1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal region of human IGF2BP1. Synthetic peptide located within the following region: AFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPP

Rabbit Polyclonal Anti-IGF2BP1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF2BP1 antibody: synthetic peptide directed towards the N terminal of human IGF2BP1. Synthetic peptide located within the following region: PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Rabbit anti-IGF2BP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGF2BP1

Goat Anti-IGF2BP1 (IMP1) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKVFAEHKISYSGQ, from the Internal region of the protein sequence according to NP_006537.3; NP_001153895.1.

Carrier-free (BSA/glycerol-free) IGF2BP1 mouse monoclonal antibody,clone OTI1F7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Anti-IGF2BP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1

Anti-IGF2BP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 554-568 amino acids of Human insulin-like growth factor 2 mRNA binding protein 1

Igf2bp1 Antibody - N-terminal region

Applications WB
Reactivities Rat, Mouse
Conjugation Unconjugated

IGF2BP1 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 480 to the C-terminus of human IGF2BP1 (NP_006537.3).
Modifications Unmodified

IGF2BP1 Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

IGF2BP1 mouse monoclonal antibody,clone OTI1F7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

IGF2BP1 mouse monoclonal antibody,clone OTI1F7

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated