Antibodies

View as table Download

IL34 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL34

Rabbit Polyclonal IL-34 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-34 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-34.

Rabbit Polyclonal IL-34 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-34 antibody was raised against a 13 amino acid peptide from near the center of human IL-34.

Rabbit Polyclonal Anti-IL34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL34 Antibody is: synthetic peptide directed towards the N-terminal region of Human IL34. Synthetic peptide located within the following region: ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP

Carrier-free (BSA/glycerol-free) IL34 mouse monoclonal antibody,clone OTI4A6

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL34 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL34 mouse monoclonal antibody,clone OTI5E1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

IL34 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL34

IL34 mouse monoclonal antibody,clone OTI4A6

Applications WB
Reactivities Human
Conjugation Unconjugated

IL34 mouse monoclonal antibody,clone OTI4A6

Applications WB
Reactivities Human
Conjugation Unconjugated

IL34 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

IL34 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated