Antibodies

Jump to Filters
View as table Download
INTS1 Rabbit Polyclonal Antibody
TA332219

USD 375.00

5 Days

Rabbit Polyclonal Anti-INTS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-INTS1 Antibody is: synthetic peptide directed towards the N-terminal region of Human INTS1. Synthetic peptide located within the following region: TVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSER
INTS1 Rabbit Polyclonal Antibody
TA350890

USD 345.00

In Stock

Rabbit Polyclonal Anti-INTS1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human INTS1