PEG3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PEG3 |
PEG3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PEG3 |
Rabbit polyclonal PEG3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PEG3. |
Rabbit Polyclonal Anti-PEG3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG |
Carrier-free (BSA/glycerol-free) PEG3 mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PEG3 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PEG3 |
PEG3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PEG3 (NP_006201.1). |
Modifications | Unmodified |
PEG3 mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody,clone OTI1B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |