Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against SFRP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRWQKGQREFKR, from the C Terminus of the protein sequence according to NP_003004.1. |
Antibodies
View as table Download
Rabbit polyclonal Anti-SFRP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRP2 antibody: synthetic peptide directed towards the middle region of human SFRP2. Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN |
SFRP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 141-295 of human SFRP2 (NP_003004.1). |
| Modifications | Unmodified |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- SFRP2
Conjugates
- Unconjugated