Antibodies

Jump to Filters
View as table Download
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA371326

USD 380.00

4 Weeks

STK17A rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA344176

USD 475.00

5 Days

Rabbit Polyclonal Anti-STK17A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-STK17A antibody is: synthetic peptide directed towards the C-terminal region of Human STK17A. Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA306006

USD 430.00

5 Days

Rabbit Polyclonal DRAK1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DRAK1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human DRAK1.
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA308817

USD 415.00

5 Days

Rabbit polyclonal antibody to DRAK1 (serine/threonine kinase 17a)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 231 of DRAK1 (Uniprot ID#Q9UEE5)
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA330331

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK17A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A. Synthetic peptide located within the following region: KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGE
DRAK1 (STK17A) Rabbit Polyclonal Antibody
TA351146

USD 345.00

In Stock

Rabbit Polyclonal Anti-STK17A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STK17A