Antibodies

View as table Download

Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-VAT1L Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vat1l antibody is: synthetic peptide directed towards the N-terminal region of Vat1l. Synthetic peptide located within the following region: FIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVN

Carrier-free (BSA/glycerol-free) VAT1L mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

VAT1L Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human VAT1L

Anti-VAT1L (KIAA1576) mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated