Antibodies

View as table Download

PAX3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PAX3

Rabbit polyclonal PAX3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3.

Rabbit Polyclonal Anti-PAX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC

Goat Polyclonal Antibody against PAX3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1.

Rabbit Polyclonal Anti-PAX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the N terminal of human PAX3. Synthetic peptide located within the following region: DRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILS

Rabbit Polyclonal Anti-PAX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the middle region of human PAX3. Synthetic peptide located within the following region: KGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDL

Carrier-free (BSA/glycerol-free) PAX3 mouse monoclonal antibody, clone OTI4D1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX3 mouse monoclonal antibody,clone OTI4D1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX3 mouse monoclonal antibody,clone OTI4D1, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PAX3 mouse monoclonal antibody,clone OTI4D1, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PAX3 mouse monoclonal antibody,clone OTI4D1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated