Rabbit polyclonal antibody to TRPM2 (transient receptor potential cation channel, subfamily M, member 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 181 and 423 of TRPM2 (Uniprot ID#O94759) |
Rabbit Polyclonal Anti-TRPM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
Germany
Japan
United Kingdom
China
