TRPM2 Rabbit Polyclonal Antibody

CAT#: TA335274

Rabbit Polyclonal Anti-TRPM2 Antibody

Product Images

TRPM2 antibody - N-terminal region validated by WB using Fetal Brain Lysate at 1 ug/ml.

• 

  Immunohistochemistry with human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes tissue

• 

  Immunohistochemistry with human LCL and mouse brains incubated for 5 minutes in CDP-Star for 5 minutes tissue

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 171 kDa
• Gene Name: transient receptor potential cation channel subfamily M member 2
• Database Link:
  NP_003298
  Entrez Gene 7226 Human
  UniProt ID O94759
• Background: TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death.The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: EREG1; KNP3; LTRPC2; NUDT9H; NUDT9L1; TRPC7
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 88%; Guinea pig: 88%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane