Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338] |
Rabbit Polyclonal TAT Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
LDHB mouse monoclonal antibody, clone AT14D7, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-AHCYL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHCY antibody: synthetic peptide directed towards the N terminal of human AHCY. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-DNMT3A antibody: mouse DNMT3 (DNA methyltransferase 3A), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein. |
CBSL rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CBS |
DNMT3A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Central region of Human DNMT3A |
DNMT3A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 871-900 amino acids from the C-terminal region of Human DNMT3A. |
DNMT3L (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 354-381 amino acids from the C-terminal region of Human DNMT3L |
Goat Polyclonal Antibody against DNMT1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFESPPKTQPTEDN, from the internal egion of the protein sequence according to NP_001370.1. |
Rabbit polyclonal anti-DNMT3L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 152-164 of Human DNMT3L (DNA (cytosine-5-)-methyltransferase 3-like). DNMT3L is a nuclear protein with similarity to DNA methyltransferases. |
Anti-LDHB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human LDHB |
Mouse monoclonal Dnmt3L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal DNMT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
LDHA Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C Terminus (SDLVKVTLTSE) |
LDHB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (near N terminus) (EEATVPNNKIT) |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE |
Rabbit Polyclonal Anti-AHCYL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AHCYL1 Antibody: synthetic peptide directed towards the N terminal of human AHCYL1. Synthetic peptide located within the following region: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE |
Rabbit Polyclonal Anti-AMD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AMD1 antibody: synthetic peptide directed towards the N terminal of human AMD1. Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against synthetic peptides corresponding to areas around amino acids 125-175 and another around 175-225 of Dnmt3a. |
Rabbit Polyclonal DNMT3A Antibody
| Applications | WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 10-50 of human Dnmt3a was used as the immunogen. |
Rabbit Polyclonal Anti-IL4I1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
Carrier-free (BSA/glycerol-free) TAT mouse monoclonal antibody,clone OTI3G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-DNMT3L Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like |
Anti-DNMT3A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha |
Anti-AMD1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-AMD1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1 |
Rabbit Polyclonal Anti-DNMT3A Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DNMT3A |
Germany
Japan
United Kingdom
China
