Antibodies

View as table Download

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Rabbit Polyclonal Antibody against RAC1 (S71)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1.

Rabbit Polyclonal Antibody against MAP2K1 (S217)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1).

Rabbit polyclonal antibody to Cofilin 2 (cofilin 2 (muscle))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 92 and 166 of Cofilin 2

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit polyclonal Akt2 (PKB beta) Antibody

Applications WB
Reactivities Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig
Conjugation Unconjugated
Immunogen A five residue synthetic peptide based on the human Akt2, coupled to KLH

Rabbit Polyclonal MEK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen.

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Chicken, Human, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Rabbit Polyclonal Anti-WASF3 Antibody

Applications WB
Reactivities Chicken, Human, Turkey
Conjugation Unconjugated
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS

Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, ChiChickenen
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins.

Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins

Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins.