Rabbit Polyclonal JMJD6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JMJD6 antibody was raised against a 15 amino acid peptide from near the amino terminus of human JMJD6. |
Rabbit Polyclonal JMJD6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JMJD6 antibody was raised against a 15 amino acid peptide from near the amino terminus of human JMJD6. |
Rabbit anti-JMJD6 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human JMJD6 |
Rabbit Polyclonal Anti-JMJD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JMJD6 antibody: synthetic peptide directed towards the N terminal of human JMJD6. Synthetic peptide located within the following region: NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADA |
Rabbit Polyclonal Anti-PTDSR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the C terminal of human PTDSR. Synthetic peptide located within the following region: VVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSD |
Rabbit polyclonal antibody to PSR (jumonji domain containing 6)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of PSR (Uniprot ID#Q6NYC1) |
Mouse Monoclonal JMJD6(N-terminus) Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-PTDSR antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the middle region of human PTDSR. Synthetic peptide located within the following region: PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE |
Rabbit Polyclonal JMJD6/PSR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human JMJD6 protein (within residues 150-350). [Swiss-Prot Q6NYC1] |
JMJD6 (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PTDSR. |
Rabbit Polyclonal Anti-JMJD6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JMJD6 |