Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the C terminal of human TRIB1. Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF

Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIB1

TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIB1 mouse monoclonal antibody, clone OTI8C8 (formerly 8C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated