Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Fish, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Goat Polyclonal Antibody against TRPM7
| Applications | WB |
| Reactivities | Mouse, Rat, CrayFish |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Active filters
Reactivities
- Fish
Families
- Druggable Genome
Filter by
Category
Antibody Hosts
Clonalities
Conjugates
Pathways
- Cell cycle (2)
- Pathways in cancer (2)
- Antigen processing and presentation (1)
- Base excision repair (1)
- Calcium signaling pathway (1)
- DNA replication (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Long-term potentiation (1)
- MAPK signaling pathway (1)
- Melanogenesis (1)
- Mismatch repair (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Nucleotide excision repair (1)
- Pathogenic Escherichia coli infection (1)
- Phosphatidylinositol signaling system (1)
- Renal cell carcinoma (1)
- Tight junction (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Wnt signaling pathway (1)
- p53 signaling pathway (1)