Antibodies

View as table Download

Rabbit Polyclonal FLASH Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FLASH antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy-terminus of human FLASH which differ from those of mouse by one amino acid.

Rabbit Polyclonal FLASH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen N-terminus of the FLASH protein.

Rabbit Polyclonal FLASH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen N-terminus of the FLASH protein (proprietary peptide).

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CASP8AP2 antibody: synthetic peptide directed towards the N terminal of human CASP8AP2. Synthetic peptide located within the following region: SLKKNISALIKTARVEINRKDEEISNLHQRLSEFPHFRNNHKTARTFDTV

Rabbit Polyclonal Anti-CASP8AP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CASP8AP2