Antibodies

Jump to Filters
View as table Download
Clusterin Rabbit Polyclonal Antibody
TA332402

USD 275.00

3 Weeks

Rabbit anti-CLU Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLU
Clusterin (CLU) Goat Polyclonal Antibody
TA303058

USD 375.00

In Stock

Goat Polyclonal Antibody against CLU

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRKKHREE, from the C Terminus of the protein sequence according to NP_001822.2; NP_976084.1.
Clusterin (CLU) Rabbit Polyclonal Antibody
TA321404

USD 345.00

4 Weeks

Anti-CLU Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human clusterin
Clusterin (CLU) Rabbit Polyclonal Antibody
TA343117

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI2A7]
CF808578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
CF808665

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Rabbit Polyclonal Antibody
TA351991

USD 345.00

In Stock

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
TA808665

USD 379.00

In Stock

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Clusterin (CLU) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D3]
TA808665AM

USD 420.00

4 Weeks

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Clusterin (CLU) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D3]
TA808665BM

USD 420.00

4 Weeks

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: OTI5D3]
TA808665S

USD 159.00

2 Days

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated