Rabbit anti-CLU Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLU |
Rabbit anti-CLU Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLU |
Goat Polyclonal Antibody against CLU
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKALQEYRKKHREE, from the C Terminus of the protein sequence according to NP_001822.2; NP_976084.1. |
Anti-CLU Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 230 amino acids of human clusterin |
Rabbit Polyclonal Anti-CLU Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN |
Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CLU Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLU |
CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |