Rabbit anti-NUP62 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NUP62 |
Rabbit anti-NUP62 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NUP62 |
Rabbit polyclonal antibody to nucleoporin p62 (nucleoporin 62kDa)
Applications | IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 230 and 490 of Nucleoporin p62 |
Rabbit Polyclonal Anti-NUP62 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NUP62 antibody: synthetic peptide directed towards the N terminal of human NUP62. Synthetic peptide located within the following region: SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA |
Rabbit polyclonal antibody to nucleoporin p62 (nucleoporin 62kDa)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 294 and 522 of nucleoporin p62 (Uniprot ID#P37198) |
Rabbit Polyclonal Anti-NUP62 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NUP62 antibody is: synthetic peptide directed towards the middle region of Human NUP62. Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA |
Rabbit Polyclonal Anti-NUP62 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NUP62 |