Rabbit Polyclonal ATR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATR antibody was raised against a peptide corresponding to 13 amino acids near the center of human ATR. |
Rabbit Polyclonal ATR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATR antibody was raised against a peptide corresponding to 13 amino acids near the center of human ATR. |
Rabbit Polyclonal ATR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ATR antibody was raised against a peptide corresponding to 13 amino acids near the C-terminus of human ATR. |
Mouse Monoclonal TEM8/ANTXR1 Antibody (200C1339(SB20))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ANTXR1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RAPPPSRPPPRPSV, from the C Terminus of the protein sequence according to NP_115584. |
Rabbit polyclonal anti-TEM-8/ATR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 484 of Mouse TEM8 |
Rabbit Polyclonal Anti-ANTXR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANTXR1 antibody: synthetic peptide directed towards the middle region of human ANTXR1. Synthetic peptide located within the following region: VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK |
Anti-ANTXR1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-332 amino acids of human anthrax toxin receptor 1 |
Anti-ANTXR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |