Antibodies

Jump to Filters
View as table Download
AKR7A3 Mouse Monoclonal Antibody [Clone ID: AT2E11]
AM39004PU-N

USD 340.00

2 Weeks

AKR7A3 mouse monoclonal antibody, clone AT2E11, Purified

Applications ELISA, WB
Reactivities Human
AKR7A3 Mouse Monoclonal Antibody [Clone ID: AT2E11]
AM39004PU-S

USD 230.00

2 Weeks

AKR7A3 mouse monoclonal antibody, clone AT2E11, Purified

Applications ELISA, WB
Reactivities Human
AKR7A3 Rabbit Polyclonal Antibody
TA334423

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKR7A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKR7A3 antibody: synthetic peptide directed towards the middle region of human AKR7A3. Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW