Antibodies

View as table Download

Rabbit Polyclonal Anti-BAZ1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAZ1B antibody: synthetic peptide directed towards the middle region of human BAZ1B. Synthetic peptide located within the following region: EQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQK

Rabbit polyclonal anti-Williams Syndrome Transcription Factor (WSTF) antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Williams Syndrome Transcription Factor (WSTF)

Carrier-free (BSA/glycerol-free) BAZ1B mouse monoclonal antibody,clone OTI3B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-BAZ1B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BAZ1B

BAZ1B mouse monoclonal antibody,clone OTI3B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-BAZ1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BAZ1B

Rabbit Polyclonal anti-BAZ1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BAZ1B

Special Offer: Get this product for $99/€99. Use code: "Truesample".