Antibodies

Jump to Filters
View as table Download
DDX41 Rabbit Polyclonal Antibody
TA319924

USD 430.00

5 Days

Rabbit Polyclonal DDX41 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDX41 antibody was raised against a 17 amino acid peptide near the amino terminus of human DDX41.
DDX41 Rabbit Polyclonal Antibody
TA341597

USD 310.00

5 Days

Rabbit Polyclonal Anti-DDX41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX41 antibody: synthetic peptide directed towards the C terminal of human DDX41. Synthetic peptide located within the following region: AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL
DDX41 Goat Polyclonal Antibody
TA327775

USD 375.00

5 Days

DDX41 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (QEERTKAIEAFRE)
DDX41 Rabbit Polyclonal Antibody
TA341596

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDX41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDX41 antibody: synthetic peptide directed towards the N terminal of human DDX41. Synthetic peptide located within the following region: RGDEDDIPLGPQSNVSLLDQHQHLKEKAEARKESAKEKQLKEEEKILESV