Antibodies

Jump to Filters
View as table Download
KCNQ3 (C-term) Rabbit Polyclonal Antibody
AP52317PU-N

USD 450.00

2 Weeks

KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3
KCNQ3 Rabbit Polyclonal Antibody
TA314137

USD 345.00

4 Weeks

Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)

Applications IHC
Reactivities Human: Thr246, Mouse: Thr247, Rat: Thr247
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K).
Modifications Phospho-specific
KCNQ3 Rabbit Polyclonal Antibody
TA338539

USD 375.00

5 Days

Rabbit Polyclonal Anti-Kcnq3 Antibody

Applications WB
Reactivities Hamster, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ