Antibodies

View as table Download

Rabbit anti-KNG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KNG1

Rabbit Polyclonal antibody to Kininogen 1 (kininogen 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 416 of HMW Kininogen

Kininogen 1 (KNG1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 145-174 amino acids from the N-terminal region of Human Kininogen-1

Kininogen 1 (KNG1) (LMW Isoform) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Highly purified Molecular Weight Kininogen isolated from pooled plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Kininogen 1 (KNG1) goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Immunogen Purified Kininogen from pooled Human plasma is used for the immunization.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit polyclonal KNG1 (heavy chain, Cleaved-Lys380) antibody

Applications WB
Reactivities Human:Lys380
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human KNG1.

Anti-KNG1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 280 amino acids of human kininogen 1

Goat Anti-kininogen 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RITEATKTVGSDT, from the internal region (near N terminus) of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.

Goat Anti-kininogen 1 (aa268-279) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRDIPTNSPELE, from the internal region of the protein sequence according to NP_001095886.1; NP_000884.1; NP_001159923.1.

Rabbit Polyclonal Anti-KNG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KNG1 antibody: synthetic peptide directed towards the middle region of human KNG1. Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

KNG1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1