Antibodies

View as table Download

Rabbit polyclonal anti-LTK antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LTK.

Rabbit Polyclonal Anti-LTK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LTK antibody: synthetic peptide directed towards the N terminal of human LTK. Synthetic peptide located within the following region: GGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSRAP