Rabbit polyclonal anti-ASPP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal sequence of human ASPP1. |
Rabbit Polyclonal Anti-PPP1R13B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP1R13B antibody: synthetic peptide directed towards the middle region of human PPP1R13B. Synthetic peptide located within the following region: EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA |
Sheep polyclonal anti-ASPP1 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ASPP1 |
Anti-ASPP1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 478-491 amino acids of Human Apoptosis-stimulating amino acids of p53 protein 1 |
Germany
Japan
United Kingdom
China