Rabbit Polyclonal Anti-PTK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTK6 antibody: synthetic peptide directed towards the middle region of human PTK6. Synthetic peptide located within the following region: SELLDIAWQVAEGMCYLESQNYIHRDLAARNILVGENTLCKVGDFGLARL |
Brk (PTK6) mouse monoclonal antibody, clone 24B7, Purified
| Applications | WB |
| Reactivities | Human |
Rabbit polyclonal anti-PTK6 (Brk) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 508 of human Brk |
Rabbit Polyclonal Anti-PTK6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PTK6 |
Germany
Japan
United Kingdom
China