Antibodies

Jump to Filters
View as table Download
RbAp48 (RBBP4) Rabbit Polyclonal Antibody
TA327056

USD 380.00

3 Weeks

RBBP4 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RBBP4
RbAp48 (RBBP4) Mouse Monoclonal Antibody [Clone ID: 2D7]
AM31028PU-N

USD 480.00

2 Weeks

RbAp48 (RBBP4) mouse monoclonal antibody, clone 2D7, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
RbAp48 (RBBP4) Rabbit Polyclonal Antibody
TA342251

USD 375.00

5 Days

Rabbit polyclonal Anti-RBBP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBBP4 antibody: synthetic peptide directed towards the N terminal of human RBBP4. Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
RbAp48 (RBBP4) Rabbit Polyclonal Antibody
TA342252

USD 375.00

5 Days

Rabbit polyclonal Anti-Rbbp4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Rbbp4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rbbp4. Synthetic peptide located within the following region: TAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQ
RbAp48 (RBBP4) Mouse Monoclonal Antibody
TA347272

USD 315.00

5 Days

Mouse Monoclonal RbAp 46/48 Antibody

Applications WB
Reactivities Human
RbAp48 (RBBP4) Mouse Monoclonal Antibody
TA347273

USD 325.00

5 Days

Mouse Monoclonal RbAp 46/48 Antibody

Applications WB
Reactivities Human