Antibodies

View as table Download

Rabbit Polyclonal Anti-TFEB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Goat Anti-TFEB (internal) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKDLQKSRELENH, from the internal region of the protein sequence according to NP_009093.1.

Rabbit Polyclonal TFEB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TFEB antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human TFEB.

Rabbit Polyclonal Anti-TFEB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the C terminal of human TFEB. Synthetic peptide located within the following region: SLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL

Rabbit Polyclonal TFEB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TFEB

Rabbit Polyclonal TFEB Antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Rabbit polyclonal TFEB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human TFEB.

Rabbit polyclonal antibody to TFEB (transcription factor EB)

Applications WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of TFEB (Uniprot ID#P19484)

Rabbit Polyclonal Anti-TFEB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFEB antibody: synthetic peptide directed towards the middle region of human TFEB. Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR