Antibodies

View as table Download

SLAMF1 mouse monoclonal antibody, clone SLAM.4, Azide Free

Applications FC, IF, IP
Reactivities Human

Rabbit Polyclonal SLAMF1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SLAMF1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human SLAMF1.

Rabbit polyclonal anti-SLAM/CD150 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Amino acids corresponding to 138-153 of human SLAM

Rabbit Polyclonal Anti-SLAMF1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Slamf1 antibody is: synthetic peptide directed towards the middle region of Mouse Slamf1. Synthetic peptide located within the following region: QVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSR

Rabbit Polyclonal Anti-SLAMF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SLAMF1

SLAMF1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated