Antibodies

View as table Download

PAX3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PAX3

Rabbit polyclonal PAX3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3.

Rabbit Polyclonal Anti-PAX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC

Goat Polyclonal Antibody against PAX3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1.

Rabbit Polyclonal Anti-PAX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the N terminal of human PAX3. Synthetic peptide located within the following region: DRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILS

Rabbit Polyclonal Anti-PAX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the middle region of human PAX3. Synthetic peptide located within the following region: KGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDL