Antibodies

View as table Download

Rabbit polyclonal anti-GPR34 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPR34.

GPR34 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 239-269aa) of human GPR34.

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: KGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIKIGKNL

Rabbit Polyclonal Anti-GPR34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH

Rabbit Polyclonal Anti-GPR34 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen GPR34 antibody was raised against synthetic 17 amino acid peptide from 2nd cytoplasmic domain of human GPR34. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Bovine, Horse (100%); Marmoset, Mouse, Rat, Elephant, Guinea pig (94%); Panda (88%); Bat, Opossum (82%).