Antibodies

Jump to Filters
View as table Download
GJB1 Rabbit Polyclonal Antibody
AP20645PU-N

USD 370.00

2 Weeks

GJB1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 81-130 of Human Connexin 32.
GJB1 Rabbit Polyclonal Antibody
TA347880

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Connexin 32 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32
GJB1 Mouse Monoclonal Antibody [Clone ID: CXN-32]
AM20614PU-N

USD 405.00

2 Weeks

GJB1 mouse monoclonal antibody, clone CXN-32, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
GJB1 Rabbit Polyclonal Antibody
TA341660

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the middle region of human GJB1. Synthetic peptide located within the following region: RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR
GJB1 Rabbit Polyclonal Antibody
TA341661

USD 310.00

5 Days

Rabbit Polyclonal Anti-GJB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
GJB1 Mouse Monoclonal Antibody [Clone ID: Connexin32]
TA353208L

USD 1,140.00

9 Weeks

Mouse monoclonal Anti-Cx32 Clone Connexin32

Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated