Rabbit polyclonal anti-NR2F6 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6. |
Rabbit polyclonal anti-NR2F6 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6. |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV |
NR2F6 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 24-53 amino acids from the N-terminal region of human NR2F6 |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP |
Rabbit Polyclonal Anti-NR2F6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP |
Rabbit Polyclonal Anti-NR2F6 Antibody (Ligand-binding Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | EAR2 / NR2F6 antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR2F6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Pig, Platypus, Xenopus, Stickleback, Pufferfish, Zebrafish (100%); Opossum (94%). |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NR2F6 mouse monoclonal antibody, clone OTI2H4 (formerly 2H4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".