GGT1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGT1 |
GGT1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GGT1 |
Rabbit anti-LTA4H Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LTA4H |
USD 379.00
In Stock
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI9C5
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700155 |
Rabbit polyclonal Gamma-glutamyltransferase 4 (heavy chain, Cleaved-Thr472) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Gamma-glutamyltransferase 4. |
Anti-GGT1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human gamma-glutamyltransferase 1 |
Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440) |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2C5
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700155 |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6B5
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700155 |
Rabbit anti-LTA4H polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human Leukotriene A4 hydrolase. |
Rabbit polyclonal Anti-GGTL3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GGTL3 antibody: synthetic peptide directed towards the C terminal of human GGTL3. Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2A9
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700150 |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3C11
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700155 |
USD 379.00
2 Weeks
LTA4H Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5C10
Applications | LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700155 |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI5C10 (formerly 5C10)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI6B5 (formerly 6B5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI8F4 (formerly 8F4)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)
Applications | IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) LTA4H mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GGT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GGT1 |
Rabbit Polyclonal Anti-LTA4H Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LTA4H |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9C5 (formerly 9C5), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9C5 (formerly 9C5), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9C5 (formerly 9C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI5C10 (formerly 5C10)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI5C10 (formerly 5C10), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI5C10 (formerly 5C10), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI5C10 (formerly 5C10)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9G8 (formerly 9G8), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9G8 (formerly 9G8), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI9G8 (formerly 9G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI7D11 (formerly 7D11), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
In Stock
LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI2C5 (formerly 2C5), Biotinylated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI2C5 (formerly 2C5), HRP conjugated
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI2C5 (formerly 2C5)
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI6B5 (formerly 6B5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI6B5 (formerly 6B5), Biotinylated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI6B5 (formerly 6B5), HRP conjugated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI6B5 (formerly 6B5)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-LTA4H (Leukotriene A4 hydrolase) mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |