Rabbit anti-COPS5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human COPS5 |
Rabbit anti-COPS5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human COPS5 |
Rabbit polyclonal anti-COPS5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COPS5. |
Rabbit Polyclonal Anti-COPS5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: NMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVM |
Rabbit Polyclonal anti-COPS5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY |
Carrier-free (BSA/glycerol-free) COPS5 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-COPS5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |