Goat Anti-AGTPBP1 / NNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Goat Anti-AGTPBP1 / NNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TSPLEYNLPS, from the internal region of the protein sequence according to NP_056054.2. |
Rabbit Polyclonal Anti-AGTPBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AGTPBP1 Antibody: synthetic peptide directed towards the N terminal of human AGTPBP1. Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 1C8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 1C8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 9B8, Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 9B8, HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI9B8 (formerly 9B8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 9A3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 9A3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 9D11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 9D11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI9D11 (formerly 9D11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
AGTPBP1 mouse monoclonal antibody,clone 9C8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
AGTPBP1 mouse monoclonal antibody,clone 9C8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
AGTPBP1 mouse monoclonal antibody, clone OTI9C8 (formerly 9C8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |