Antibodies

View as table Download

Rabbit Polyclonal ASK1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ASK1.

Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal ASK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1.

Rabbit anti-MAP2K6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAP2K6

Rabbit polyclonal p38 MAPK (Ab-322) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q).

Rabbit anti-MAPK14 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human MAPK14

Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) .
Modifications Phospho-specific

Rabbit polyclonal MKK3 (Ab-189) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MKK6 around the phosphorylation site of Serine207.

Rabbit polyclonal MAP2K3/MKK3 (Ser189) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A).
Modifications Phospho-specific

Anti-MAP3K5 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.81~85 (G-S-S-V-G) derived from Human ASK1.

Rabbit Polyclonal p38 MAPK (Tyr322) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 322
Modifications Phospho-specific

Rabbit polyclonal MKK6 (Phospho-Ser207) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A).
Modifications Phospho-specific

Rabbit polyclonal MKK6 (Ab-207) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MKK3 around the phosphorylation site of Serine189.

Rabbit polyclonal p38 MAPK (Ab-179/181) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human p38 MAPK.

Rabbit Polyclonal ASK1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids.

Rabbit polyclonal anti-MAP2K6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human MAP2K6.

Anti-MAP3K5 (Phospho-Ser966) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 966 (S-I-S(p)-L-P) derived from Human ASK1.
Modifications Phospho-specific

Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14.

Rabbit Polyclonal MKK3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MKK3

Rabbit Polyclonal MKK3 (Ser189) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MKK3 around the phosphorylation site of Serine 189
Modifications Phospho-specific

Rabbit Polyclonal p38 MAPK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK

Rabbit Polyclonal p38 MAPK (Thr180) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Threonine 180
Modifications Phospho-specific

Rabbit Polyclonal p38 MAPK (Tyr182) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 182
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Phospho-Thr180) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P38 MAPK around the phosphorylation site of threonine 179 (E-M-TP-G-Y).
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Phospho-Thr179+Tyr181) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p38 MAPK around the phosphorylation site of threonine 179 and tyrosine 181 (E-M-TP-G-YP-V-A).
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Ab-182) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P38MAPK around the phosphorylation site of tyrosine 182 (T-G-YP-V-A).

Rabbit polyclonal MAP2K3 (Ab-222) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MAP2K3 around the phosphorylation site of threonine 222 (A-K-TP-M-D).

Rabbit anti-MAP2K6 (MKK6, Phospho-Ser207) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanMKK6 around the phosphorylation site of serine 207 (V-D-SP-V-A).
Modifications Phospho-specific

Anti-MAPK14 (Phospho-Thr180) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 180 (E-M-T(p)-G-Y ) derived from Human MAPK14.
Modifications Phospho-specific

Anti-MAPK14 (Phospho-Tyr182) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 182 (T-G-Y(p)-V-A) derived from Human MAPK14.
Modifications Phospho-specific

Rabbit Polyclonal ASK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ASK1

Rabbit Polyclonal ASK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ASK1

Rabbit Polyclonal ASK1 (Ser83) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ASK1 around the phosphorylation site of Serine 83
Modifications Phospho-specific

Rabbit Polyclonal ASK1 (Ser966) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ASK1 around the phosphorylation site of Serine 966
Modifications Phospho-specific

Anti-MAPK14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 180~184 (T-G-Y-V-A) derived from Human MAPK14.

Rabbit polyclonal Anti-MAPK12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Rabbit anti MKK3 Polyclonal Antibody

Reactivities Human, Rat
Conjugation Unconjugated

Rabbit anti MKK6 Polyclonal Antibody

Reactivities Human, Rat
Conjugation Unconjugated

Rabbit anti Mek6 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MAP2K6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 31-297 amino acids of human mitogen-activated protein kinase kinase 6

Anti-MAP2K6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 31-297 amino acids of human mitogen-activated protein kinase kinase 6

Anti-MAP3K5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human mitogen-activated protein kinase kinase kinase 5

Rabbit Polyclonal Anti-MAPK12 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAPK12

Rabbit Polyclonal Anti-MAPK11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAPK11

Rabbit Polyclonal Anti-MAPK13 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAPK13

Rabbit polyclonal anti-MAP3K5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAP3K5

Rabbit polyclonal anti-MAP3K5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAP3K5