Rabbit Polyclonal ASK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ASK1. |
Rabbit Polyclonal ASK1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ASK1. |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
Modifications | Phospho-specific |
Rabbit Polyclonal ASK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1. |
Rabbit anti-MAP2K6 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP2K6 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit anti-MAPK14 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human MAPK14 |
Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) . |
Modifications | Phospho-specific |
Rabbit polyclonal MKK3 (Ab-189) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MKK6 around the phosphorylation site of Serine207. |
Rabbit polyclonal MAP2K3/MKK3 (Ser189) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A). |
Modifications | Phospho-specific |
Anti-MAP3K5 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.81~85 (G-S-S-V-G) derived from Human ASK1. |
Rabbit Polyclonal p38 MAPK (Tyr322) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 322 |
Modifications | Phospho-specific |
Rabbit polyclonal MKK6 (Phospho-Ser207) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A). |
Modifications | Phospho-specific |
Rabbit polyclonal MKK6 (Ab-207) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MKK3 around the phosphorylation site of Serine189. |
Rabbit polyclonal p38 MAPK (Ab-179/181) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human p38 MAPK. |
Rabbit Polyclonal ASK1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids. |
Rabbit polyclonal anti-MAP2K6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MAP2K6. |
Anti-MAP3K5 (Phospho-Ser966) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 966 (S-I-S(p)-L-P) derived from Human ASK1. |
Modifications | Phospho-specific |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit Polyclonal MKK3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MKK3 |
Rabbit Polyclonal MKK3 (Ser189) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MKK3 around the phosphorylation site of Serine 189 |
Modifications | Phospho-specific |
Rabbit Polyclonal p38 MAPK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK |
Rabbit Polyclonal p38 MAPK (Thr180) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Threonine 180 |
Modifications | Phospho-specific |
Rabbit Polyclonal p38 MAPK (Tyr182) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 182 |
Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Phospho-Thr180) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human P38 MAPK around the phosphorylation site of threonine 179 (E-M-TP-G-Y). |
Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Phospho-Thr179+Tyr181) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p38 MAPK around the phosphorylation site of threonine 179 and tyrosine 181 (E-M-TP-G-YP-V-A). |
Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-182) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human P38MAPK around the phosphorylation site of tyrosine 182 (T-G-YP-V-A). |
Rabbit polyclonal MAP2K3 (Ab-222) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAP2K3 around the phosphorylation site of threonine 222 (A-K-TP-M-D). |
Rabbit anti-MAP2K6 (MKK6, Phospho-Ser207) polyclonal antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanMKK6 around the phosphorylation site of serine 207 (V-D-SP-V-A). |
Modifications | Phospho-specific |
Anti-MAPK14 (Phospho-Thr180) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 180 (E-M-T(p)-G-Y ) derived from Human MAPK14. |
Modifications | Phospho-specific |
Anti-MAPK14 (Phospho-Tyr182) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 182 (T-G-Y(p)-V-A) derived from Human MAPK14. |
Modifications | Phospho-specific |
Rabbit Polyclonal ASK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ASK1 |
Rabbit Polyclonal ASK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ASK1 |
Rabbit Polyclonal ASK1 (Ser83) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ASK1 around the phosphorylation site of Serine 83 |
Modifications | Phospho-specific |
Rabbit Polyclonal ASK1 (Ser966) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ASK1 around the phosphorylation site of Serine 966 |
Modifications | Phospho-specific |
Anti-MAPK14 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa. 180~184 (T-G-Y-V-A) derived from Human MAPK14. |
Rabbit polyclonal Anti-MAPK12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAPK12 antibody: synthetic peptide directed towards the N terminal of human MAPK12. Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE |
Rabbit anti MKK3 Polyclonal Antibody
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti MKK6 Polyclonal Antibody
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti Mek6 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-MAP2K6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 31-297 amino acids of human mitogen-activated protein kinase kinase 6 |
Anti-MAP2K6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 31-297 amino acids of human mitogen-activated protein kinase kinase 6 |
Anti-MAP3K5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human mitogen-activated protein kinase kinase kinase 5 |
Rabbit Polyclonal Anti-MAPK12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAPK12 |
Rabbit Polyclonal Anti-MAPK11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK11 |
Rabbit Polyclonal Anti-MAPK13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MAPK13 |
Rabbit polyclonal anti-MAP3K5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP3K5 |
Rabbit polyclonal anti-MAP3K5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAP3K5 |