Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-PRKCB Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCB |
Rabbit polyclonal PKC a (Ab-657) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
Rabbit polyclonal anti-PRKCG antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKCG. |
Anti-PRKCB (Phospho-Thr641) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 641 (E-L-T(p)-P-T) derived from Human PKCβ |
| Modifications | Phospho-specific |
Rabbit polyclonal PRKCG (Ab-655) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PRKCG around the phosphorylation site of threonine 655 (A-L-TP-P-P). |
Rabbit Polyclonal Phospho-PKCB (Ser661) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB around the phosphorylation site of Serine 661 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC alpha (Thr638) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha around the phosphorylation site of Threonine 638 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PKC-pan (Thr497) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan around the phosphorylation site of Threonine 497 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKCB |
Rabbit Polyclonal PKC alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC alpha |
Rabbit Polyclonal PKC-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PKC-pan |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal PKC a (Tyr657) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKC a around the phosphorylation site of tyrosine 657 (F-S-YP-V-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PKC beta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the C-terminus of mouse PKC β1 |
PKC alpha (PRKCA) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PRKCA |
PKC beta 1 (PRKCB) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
PKC alpha (PRKCA) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
PKC gamma (PRKCG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human PKC gamma |
Rabbit polyclonal Anti-PRKCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC |
Rabbit polyclonal Anti-PRKCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCB1 antibody: synthetic peptide directed towards the N terminal of human PRKCB1. Synthetic peptide located within the following region: CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the middle region of human PRKCG. Synthetic peptide located within the following region: WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG |
Goat Anti-PRKCB, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKEFTRQPVELT., from the internal region (near C terminus) of the protein sequence according to NP_997700.1. |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Rabbit Polyclonal Anti-PRKCB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCB |
Rabbit Polyclonal Anti-PRKCG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PRKCG |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI3D2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
PRKCA mouse monoclonal antibody, clone OTI5F4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Families
- Protein Kinase
Pathways
- Phosphatidylinositol signaling system