Rabbit Polyclonal Anti-DKK4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK4 |
Rabbit Polyclonal Anti-DKK4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK4 |
Goat Polyclonal Antibody against DKK1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Monoclonal antibody against WNT5B
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-WIF1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human WIF1 |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
Rabbit Polyclonal Anti-DKK2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK2 |
Rabbit Polyclonal Anti-WNT9B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit Polyclonal Anti-DKK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Goat Polyclonal Anti-NPHS2 / SRN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1. |
Rabbit Polyclonal Wnt10b Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b. |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal Anti-DKK2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK2 |
Goat Anti-SFRP4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TNSSCQCPHILPHQD, from the internal region of the protein sequence according to NP_003005.2. |
Rabbit Polyclonal Wnt10a Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Wnt10a antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Wnt10a. |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
Goat Polyclonal Antibody against WNT4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
WNT2B Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal anti-Wnt-6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit Polyclonal Anti-WNT10B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit Polyclonal Anti-WNT9B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA |
Rabbit Polyclonal Anti-WNT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-WNT2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLL |
Rabbit Polyclonal Anti-WNT5B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the C terminal of human WNT5B. Synthetic peptide located within the following region: GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Goat Polyclonal Antibody against DKK4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RQHARLRVCQKIEKL, from the C Terminus of the protein sequence according to NP_055235. |
Rabbit polyclonal anti-WNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Anti-WNT5A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal WNT10B Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Rabbit Polyclonal Wnt-5a Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal WNT2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT4 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal WNT5B Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal WNT8A Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A |
Goat Polyclonal Antibody against WNT3
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CGRGHNTRTEKRKEK, from the internal region of the protein sequence according to NP_110380.1. |
WNT7A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Immunogen | WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit polyclonal anti-SFRP1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SFRP1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a 12 aa region of human Sfrp1 protein. |
Anti-WNT9A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Rabbit polyclonal WNT16 Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16. |